DPCfam | MC169935
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 3.94 |
| Predicted disordered residues (%) | 9.57 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF05648 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 39.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6P6M5 | 1-84 | 84 | MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCRTVLRLFDDLAMFVYTKQYGLGTKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4AEJ6-F1 | 5-84 | 98.68 | 94.45 | View in AlphaFoldDB ↗ |