DPCfam | MC169699
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 126 ± 5 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.77 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF13181 |
| Sequences matching dominant architecture (%) | 1.85 |
| Average overlap percent | 22.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N2ACD9 | 85-193 | 109 | RAVHMAATFRLERLHPSILLSFYLTVSQGYMKFGDTEKAIDALERYTLLAIGNIYPLHLHGDNFFDLVDDWLEKTLALGDVLPLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MEH9-F1 | 160-224 | 46.83 | 96.48 | View in AlphaFoldDB ↗ |