DPCfam | MC169653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 370 ± 40 aa |
| Residues in low-complexity regions (%) | 4.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07929 |
| Sequences matching dominant architecture (%) | 95.92 |
| Average overlap percent | 45.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E8D1I4 | 55-437 | 383 | LLTVHLSLDDTDPQVWRRLTIAGDLDLDDVHHVLQAAMGWTDSHLHRFHLGDAWSGPHFLTGDDLDEGEDGTAETEARLDQILRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P50361-F1 | 5-187 | 51.76 | 94.23 | View in AlphaFoldDB ↗ |