DPCfam | MC16963
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 197 ± 17 aa |
| Residues in low-complexity regions (%) | 3.75 |
| Residues in coiled-coil regions (%) | 1.27 |
| Predicted disordered residues (%) | 41.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13560 |
| Sequences matching dominant architecture (%) | 45.95 |
| Average overlap percent | 29.15 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A164JH66 | 1-204 | 204 | MLEERRAARGLSQRKAAEMIGLSHTSLRNIESGESVPRKRTCSKLDDMYGYLDGSVYNMYRYDQAPIERETPAPPPAPRLPTGEF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F6G7-F1 | 14-220 | 100.00 | 86.26 | View in AlphaFoldDB ↗ |