DPCfam | MC169457
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Residues in low-complexity regions (%) | 3.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00561 |
| Sequences matching dominant architecture (%) | 88.37 |
| Average overlap percent | 32.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7A6G3 | 108-211 | 104 | IVAALWPERVQGLLSCGVGYNIQDIAGAANPAPPEEEALYWYMYYFHTLRGRTALENNRKGLCQFIWKIWSPTWAFDQATYDATA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EXQ1-F1 | 166-268 | 100.00 | 97.46 | View in AlphaFoldDB ↗ |