DPCfam | MC169366
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Residues in low-complexity regions (%) | 0.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09700 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U7D8L6 | 1-110 | 110 | MSWYKFIPSDTFFLRGAEPLAAGMEYETPTIFPPAPSVLCGAMRTAVLSQNDITIRQFKKGVSDLERYIGKFGASAPFSVTGVFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8U1S7-F1 | 4-87 | 96.04 | 83.62 | View in AlphaFoldDB ↗ |