DPCfam | MC168798
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 151 ± 29 aa |
| Residues in low-complexity regions (%) | 0.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02899 |
| Sequences matching dominant architecture (%) | 0.99 |
| Average overlap percent | 77.61 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2XCV6 | 34-196 | 163 | QKEPLTAENARKACTSSRTQTAYRSYLRGIATWIRESQSDPERFFDDAGNIDINVFSPKHFEAFLVAKMNASGRVLKVTTLGGYR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O42143-F1 | 158-210 | 30.13 | 69.08 | View in AlphaFoldDB ↗ |