DPCfam | MC168743
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U5G7L0 | 481-593 | 112 | SLASALQLWASMMRDTGVDLETYGRTEDYLLHSQITECWIPVAMLHTHETLDSPFGSSDLMCPALARIIGLNYGPEPEDWHLWVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VQF7-F1 | 439-558 | 99.05 | 73.52 | View in AlphaFoldDB ↗ |