DPCfam | MC16840
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Residues in low-complexity regions (%) | 10.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01636 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 36.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B2HDF3 | 2-139 | 138 | STSALQAAVSLAAAHGVVSTDPVVLKDGSNVIVHLRPAPVVARVAARTALVRPAVASHFGRDLAISAFLAARGVPVVTPSGELPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EV50-F1 | 11-144 | 98.51 | 97.33 | View in AlphaFoldDB ↗ |