DPCfam | MC168188
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Residues in low-complexity regions (%) | 3.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.43 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03946- PF00298 |
| Sequences matching dominant architecture (%) | 77.34 |
| Average overlap percent | 92.96 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4BS12 | 7-117 | 111 | KPTSLTYGVLQFCAFLSNVSVVPSAAALVIKALKETEHDRMKTKNIKHNSNNSLDVVIKIAKVMQPRSMVNDISGTVKEILGTYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WEU9-F1 | 15-155 | 98.50 | 90.74 | View in AlphaFoldDB ↗ |