DPCfam | MC168051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Residues in low-complexity regions (%) | 7.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18362- PF07679 |
| Sequences matching dominant architecture (%) | 53.57 |
| Average overlap percent | 67.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094E373D | 158-259 | 102 | AKKRPEKVEEEVDVWELLKNAHPSEYEKIAFKYGITDLRGMLRRLKKMKVEPKHSEAFLTKLESCYTVDKGKRIVLKCEVMDPNA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P56741-F1 | 310-406 | 98.00 | 71.82 | View in AlphaFoldDB ↗ |