DPCfam | MC167941
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 273 ± 38 aa |
| Residues in low-complexity regions (%) | 12.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.64 |
| Average transmembrane regions | 5.9 |
| Dominant Pfam architecture(s) | PF00924 |
| Sequences matching dominant architecture (%) | 75.51 |
| Average overlap percent | 2.34 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W0QZD3 | 208-434 | 227 | GNITSSIAVFTGLFAAVIFGVLVVRLRRPVAHLIRNRPLAQRLKHPALQQSLRVFSGLWYWPILLMVLVSAINLIGAGDDNQKAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P75783-F1 | 229-520 | 100.00 | 86.00 | View in AlphaFoldDB ↗ |