DPCfam | MC167498
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 293 ± 74 aa |
| Residues in low-complexity regions (%) | 6.27 |
| Residues in coiled-coil regions (%) | 22.35 |
| Predicted disordered residues (%) | 54.67 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF07557 |
| Sequences matching dominant architecture (%) | 45.31 |
| Average overlap percent | 6.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M8BF55 | 6-497 | 491 | KENAKLAQLVAQKTKIIELSGVEINKLRAALHSTHQQNLHLAQAHSQITAMVLVVAVKNFSGTSRVANPSSVNAYILVIPELNQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E3VXF2-F1 | 31-277 | 77.93 | 67.43 | View in AlphaFoldDB ↗ |