DPCfam | MC167435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 531 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 15.86 |
| Predicted disordered residues (%) | 34.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09361 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 82.95 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7ZCK8 | 10-124 | 115 | IGKFEIPSEVRSYAEASVDQARKAFDQFMTAARHTVTTLDERSAPEKRSGQDVSRQVLTFTDENVAAAFSLALNLVKAATVEEVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55694-F1 | 36-128 | 78.81 | 93.01 | View in AlphaFoldDB ↗ |