DPCfam | MC167261
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 731 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Residues in low-complexity regions (%) | 2.95 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 22.79 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04969 |
| Sequences matching dominant architecture (%) | 54.0 |
| Average overlap percent | 63.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3PSS1 | 5-120 | 116 | PAKTLWYDRPRYVYLEFCVEDSRDVEVLIEEQRLVFRNADGVEFYNEIDLYARVNSKDSREKRSDRSXTCFMRKWKEKVAWPRIT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7SY06-F1 | 5-117 | 98.17 | 90.35 | View in AlphaFoldDB ↗ |