DPCfam | MC16721
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Residues in low-complexity regions (%) | 4.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07715 |
| Sequences matching dominant architecture (%) | 50.68 |
| Average overlap percent | 1.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2E004F | 149-282 | 134 | GGVVNMRDLRIPRELPDGTVHVDAVAGLASAAEERNVAASLNASLGGGFVAHVDASIFGSGDYRTGGFIFGRELRKEAAEEGGEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F7H3-F1 | 153-268 | 100.00 | 97.06 | View in AlphaFoldDB ↗ |