DPCfam | MC167030
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 451 |
|---|---|
| Mean domain length (aa) | 123 ± 27 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.08 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF15711 |
| Sequences matching dominant architecture (%) | 97.33 |
| Average overlap percent | 75.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7B2Y4 | 73-189 | 117 | SGGGKEKLAKICFEDELLISEQKGNVGRGINIAIVNYKTGKVISTEFFDMWEGDFSGPMTTFIKNAPQGSLLLMVTHDDGSSRLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q688B0-F1 | 295-426 | 97.79 | 87.62 | View in AlphaFoldDB ↗ |