DPCfam | MC166978
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Residues in low-complexity regions (%) | 4.48 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 16.82 |
| Average transmembrane regions | 1.72 |
| Dominant Pfam architecture(s) | PF03669 |
| Sequences matching dominant architecture (%) | 71.51 |
| Average overlap percent | 90.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9Y284 | 6-99 | 94 | MSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQMMSSFMLSISA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VS72-F1 | 7-100 | 98.95 | 58.60 | View in AlphaFoldDB ↗ |