DPCfam | MC166945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 8031 |
|---|---|
| Mean domain length (aa) | 88 ± 17 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01979 |
| Sequences matching dominant architecture (%) | 72.99 |
| Average overlap percent | 37.12 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101DXR2 | 285-350 | 66 | FEGVLTRAIEMGVEPVEAVAMVSLNPAQYFNLDGFGEIAVGKRADIVLTDGLEDISIQRVLVGGKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5L083-F1 | 318-416 | 96.49 | 98.23 | View in AlphaFoldDB ↗ |