DPCfam | MC166717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Residues in low-complexity regions (%) | 7.35 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 19.97 |
| Average transmembrane regions | 0.25 |
| Dominant Pfam architecture(s) | PF11916 |
| Sequences matching dominant architecture (%) | 96.24 |
| Average overlap percent | 27.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8BY48 | 630-732 | 103 | DKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKGDSPSIDYTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W511-F1 | 698-816 | 98.32 | 77.19 | View in AlphaFoldDB ↗ |