DPCfam | MC166675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 806 ± 91 aa |
| Residues in low-complexity regions (%) | 5.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074WPM8 | 87-901 | 815 | KWTIDLQSAVFLKQVASLDVAPFPEILRQRNTSLDHKVEPLLLSTDPELEQRRFIRARNLRRNKASQEVSSEALWQDDQAAPLYW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NRR9-F1 | 99-989 | 99.26 | 56.08 | View in AlphaFoldDB ↗ |