DPCfam | MC1666
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 369 ± 37 aa |
| Residues in low-complexity regions (%) | 2.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.76 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00589 |
| Sequences matching dominant architecture (%) | 78.05 |
| Average overlap percent | 12.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B1NUQ9 | 553-996 | 444 | VPLFRLLLPSEQKVMDEYLRDKKTQEPSEDSLLFTFRDPYQPFDTSEVSVVVGKLLRKLSGLDHLVLYHLRHSCFSRMQLIAELD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NNZ9-F1 | 228-295 | 20.57 | 90.95 | View in AlphaFoldDB ↗ |