DPCfam | MC16657
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 102 ± 20 aa |
| Residues in low-complexity regions (%) | 2.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.88 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01157 |
| Sequences matching dominant architecture (%) | 96.57 |
| Average overlap percent | 86.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J3K5D8 | 2-86 | 85 | EHGPTHLSTYMINFKLGDIVDIKGSGKVHKGMPHKYYHGKTGRVWNVTPRAVGVEVNKQVRNRIIRKRIHVRVEHIKRSTCQADF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6KTT8-F1 | 4-107 | 97.20 | 94.71 | View in AlphaFoldDB ↗ |