DPCfam | MC166436
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4851 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Residues in low-complexity regions (%) | 4.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.62 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF02775 |
| Sequences matching dominant architecture (%) | 93.59 |
| Average overlap percent | 87.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4SCM0 | 105-243 | 139 | FDKETGFLGGNGIMGAGIPIALGAAYRAKYKNSNQVCVCFFGDGSSTQGTFHESLNISALWKLPLIYICENNLYAVSTPVSEEVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W574-F1 | 408-542 | 86.32 | 97.68 | View in AlphaFoldDB ↗ |