DPCfam | MC166432
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 231 ± 26 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.09 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF06934 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0A3E6 | 20-245 | 226 | PLFAVEINNPKNSQVTHLAQTISYADDIQPLLNKRCATCHACYDAPCQLKLNSAEGLARGATKTAVYDGERLEPGEPTRLFVDAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2P9-F1 | 19-233 | 94.83 | 93.62 | View in AlphaFoldDB ↗ |