DPCfam | MC166425
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Residues in low-complexity regions (%) | 0.75 |
| Residues in coiled-coil regions (%) | 0.49 |
| Predicted disordered residues (%) | 16.02 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3F0Y3 | 170-270 | 101 | VDQAEEWRRKSLANLTQHIQTTIDRIQNPSNCSKAKILVCNLDKQCGFGCQLHHVAYCFVVAFGEGRTLVMEGDGKEWRYSHNGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9N0W2-F1 | 171-267 | 98.98 | 97.34 | View in AlphaFoldDB ↗ |