DPCfam | MC166339
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Residues in low-complexity regions (%) | 1.58 |
| Residues in coiled-coil regions (%) | 3.06 |
| Predicted disordered residues (%) | 52.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12925 |
| Sequences matching dominant architecture (%) | 95.35 |
| Average overlap percent | 43.34 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947DFA1 | 276-344 | 69 | DPYFLEEDSDNEHKMFLEARKRVEEKHRLRMTQVMKQWEEAEERYQELKSKDPNGAELMKKEMMERFQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6PIH7-F1 | 274-352 | 96.34 | 86.43 | View in AlphaFoldDB ↗ |