DPCfam | MC166115
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 205 ± 18 aa |
| Residues in low-complexity regions (%) | 0.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.32 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13708 |
| Sequences matching dominant architecture (%) | 99.28 |
| Average overlap percent | 89.99 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I6RTT5 | 72-263 | 192 | NLEDGIALLNSNYWQRAMNMTDVYDHMPQKRRDEWHDMIRERKCPAFEVASVYATFEDLLRMRSQFIAERVDGIFRSLSGEHVTN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32HN4-F1 | 81-278 | 98.50 | 90.83 | View in AlphaFoldDB ↗ |