DPCfam | MC166079
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 419 ± 23 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13676 |
| Sequences matching dominant architecture (%) | 92.45 |
| Average overlap percent | 29.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q5ZS57 | 2-434 | 433 | RDTIFISHATPEDNEFTVWLASRLELLGYKVWIDKKELLGGETFWETIELAIKNDAAKFLLVYSKNICYADGSGVVKNGIQKEID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55386-F1 | 186-611 | 99.53 | 90.89 | View in AlphaFoldDB ↗ |