DPCfam | MC166045
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 721 ± 112 aa |
| Residues in low-complexity regions (%) | 4.97 |
| Residues in coiled-coil regions (%) | 15.32 |
| Predicted disordered residues (%) | 23.18 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF18276 |
| Sequences matching dominant architecture (%) | 85.43 |
| Average overlap percent | 41.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3ENZ8 | 724-1467 | 744 | VGTRLSEEGRYHEAQQWFEYIFNPLLREIPESPGVIPKPAYWNCRPLKIDDVECSYESAAPTDPDAIGYCAPIHFMIAIFLHYVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6A878-F1 | 625-1346 | 98.15 | 83.63 | View in AlphaFoldDB ↗ |