DPCfam | MC16604
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 215 ± 26 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.78 |
| Average transmembrane regions | 0.62 |
| Dominant Pfam architecture(s) | PF10140 |
| Sequences matching dominant architecture (%) | 91.3 |
| Average overlap percent | 60.41 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I6SX89 | 58-259 | 202 | EKLIIQYKKTNQMKCFSQVLIKLDFYQRLLLAQKVNQLCDFMNGPIQPLFHPDNLFLFGEEIFLAHRGFMQVIAPYTVTENDFLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H2XG66-F1 | 34-248 | 96.41 | 93.03 | View in AlphaFoldDB ↗ |