DPCfam | MC165832
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Residues in low-complexity regions (%) | 10.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02861 |
| Sequences matching dominant architecture (%) | 15.38 |
| Average overlap percent | 27.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7M813 | 160-235 | 76 | ILDDPIVSRVFAEAGFRSCDIKLALLQPPLPPVQHRFNWSPPVFLCNLDPAQPDENIRRIMEVLARKNKRNPLLMG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O80875-F1 | 149-244 | 98.99 | 63.86 | View in AlphaFoldDB ↗ |