DPCfam | MC165827
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 140 ± 20 aa |
| Residues in low-complexity regions (%) | 6.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.04 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090KX11 | 192-322 | 131 | LSVRIAAINCLHALVKEYPTLYTMDIDGVATLLIKSLDVSNYHTRLAVADVFATLTKLAIKNTQINNSQGQNNGNGKYWTIESSF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7F9C7-F1 | 192-332 | 100.00 | 81.98 | View in AlphaFoldDB ↗ |