DPCfam | MC165803
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Residues in low-complexity regions (%) | 13.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.89 |
| Average transmembrane regions | 2.85 |
| Dominant Pfam architecture(s) | PF16931 |
| Sequences matching dominant architecture (%) | 96.91 |
| Average overlap percent | 92.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A198UUK9 | 1-112 | 112 | MAEPSTTSAASVAAIMSATAFLPFVNGDALLGSVLGAALFATTKKDLKPLSRLGTLLLSTGCGYYIGPEVIEHSFIDGEALASMV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I549-F1 | 10-110 | 98.13 | 89.04 | View in AlphaFoldDB ↗ |