DPCfam | MC165653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 238 ± 27 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17888 |
| Sequences matching dominant architecture (%) | 44.7 |
| Average overlap percent | 37.19 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5VZK9 | 38-283 | 246 | GDKVENKVLVLTSCRAFLVTARIPTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5VZK9-F1 | 32-282 | 100.00 | 91.14 | View in AlphaFoldDB ↗ |