DPCfam | MC165491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 383 ± 40 aa |
| Residues in low-complexity regions (%) | 9.82 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 4.31 |
| Average transmembrane regions | 9.82 |
| Dominant Pfam architecture(s) | PF03616 |
| Sequences matching dominant architecture (%) | 80.35 |
| Average overlap percent | 86.32 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M6ZYE5 | 15-426 | 412 | ILSGLLLAGFFLRAKIKLFQNLFLPASVIGGFLGLLLGPVVLKTHAVLPIPDEFIKDFALIPGILILPIIASVPLGLGLDPMQTP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45240-F1 | 10-393 | 99.75 | 89.14 | View in AlphaFoldDB ↗ |