DPCfam | MC165421
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 175 ± 26 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.32 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09773 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.76 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M4AFF3 | 212-369 | 158 | IQSAWFVENLYSSSAACLDYSNLTACQALGNMCVLSMHSITGSSTDACGLFNTVYKSKAALSSVQEIAYWRVNLPWLFYGDEPGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4F6U1-F1 | 113-274 | 98.75 | 89.56 | View in AlphaFoldDB ↗ |