DPCfam | MC165348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 180 ± 24 aa |
| Residues in low-complexity regions (%) | 5.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18759 |
| Sequences matching dominant architecture (%) | 13.29 |
| Average overlap percent | 4.52 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3DGC7 | 17-148 | 132 | CPDCGKQFANRTNILRHMNQRSNTCSSIMNGISYYEPYAPRATQVPDLFDEAQCDRLEETPEWECDQVDFNMLDSDVSTRSPHPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8RHP4-F1 | 262-283 | 11.46 | 91.62 | View in AlphaFoldDB ↗ |