DPCfam | MC165258
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10124 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 47.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009BE7CE0 | 51-116 | 66 | EKPMWLLLDTTRPINPFIWQERIPYQVQQLTSSDDTGTFINDEYYYGVRGRGNMGYGFWQMAFASK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44227-F1 | 168-231 | 95.52 | 96.48 | View in AlphaFoldDB ↗ |