DPCfam | MC165207
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Residues in low-complexity regions (%) | 2.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.41 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF14776 |
| Sequences matching dominant architecture (%) | 1.59 |
| Average overlap percent | 18.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007D93327 | 302-425 | 124 | NYVDKHFYMAPHKLRYSAAFSVFITNLPQLLDQNHTMGMFMIQPILTILQNCACPPQKSFVVDSCSPTYSLWCLESQCRRSWLMA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZSV8-F1 | 1177-1284 | 98.21 | 79.56 | View in AlphaFoldDB ↗ |