DPCfam | MC16517
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Residues in low-complexity regions (%) | 6.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.51 |
| Average transmembrane regions | 1.77 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082A2AC1 | 85-190 | 106 | SRIMTWGMFLCAILSFPLFYYLGWTGIIIFLILWGVSLYYAHQVDRFKKKYDLKTIKELIAYSEGKSLSKIAKREEKAKTPYQNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FUQ8-F1 | 85-181 | 99.00 | 92.52 | View in AlphaFoldDB ↗ |