DPCfam | MC165039
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15890 |
| Sequences matching dominant architecture (%) | 12.2 |
| Average overlap percent | 26.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R8Q076 | 295-364 | 70 | EKHGEFVSLYGTTNVAEDIADTFTAFILQDSKKVKEGTELKYEKIAFFYQFPELVKMRAEVLAGLYDISR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9U0K0-F1 | 519-547 | 44.44 | 94.46 | View in AlphaFoldDB ↗ |