DPCfam | MC164817
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 197 ± 16 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12449 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 7.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4IP79 | 1151-1379 | 229 | GKIVLIDNTMLAESFETLSAPRDDLLESLYENLGSQWLSHAVTEQCEPGSIIANANDMADELLQRIKERLPVILYRKKDLELRPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CQ04-F1 | 1202-1400 | 99.01 | 84.82 | View in AlphaFoldDB ↗ |