DPCfam | MC164777
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Residues in low-complexity regions (%) | 5.16 |
| Residues in coiled-coil regions (%) | 2.48 |
| Predicted disordered residues (%) | 5.28 |
| Average transmembrane regions | 1.8 |
| Dominant Pfam architecture(s) | PF10104 |
| Sequences matching dominant architecture (%) | 99.68 |
| Average overlap percent | 92.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X0QXR0 | 62-188 | 127 | TIYYITSLLKVGFFSIIFSVLFYLFIQFARFIHQDMNAKITNYEFNQLNEQKYCQRQYEINNCSPNTRLPAIADLCESLENCLWR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1D2R3-F1 | 228-361 | 99.26 | 80.93 | View in AlphaFoldDB ↗ |