DPCfam | MC164747
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 275 ± 32 aa |
| Residues in low-complexity regions (%) | 5.17 |
| Residues in coiled-coil regions (%) | 20.46 |
| Predicted disordered residues (%) | 28.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1VBL3 | 18-325 | 308 | LIATILFLAAAGWLFLNRQYVLDQIVVWQYSPTKSIEQLVTESGMGEKGRFYFYASRPVLSDASSFNQECKRQEESSAILGCYSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57UV7-F1 | 1177-1269 | 32.38 | 70.58 | View in AlphaFoldDB ↗ |