DPCfam | MC164644
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Residues in low-complexity regions (%) | 1.26 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 11.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16497 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 56.54 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P15812-7 | 32-121 | 90 | EEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P29016-F1 | 22-113 | 98.92 | 96.63 | View in AlphaFoldDB ↗ |