DPCfam | MC164554
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1861 |
|---|---|
| Mean domain length (aa) | 328 ± 52 aa |
| Residues in low-complexity regions (%) | 2.82 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 26.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01523 |
| Sequences matching dominant architecture (%) | 99.58 |
| Average overlap percent | 51.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M4VA36 | 77-418 | 342 | NENLLNTLERLRRELPKIDPNPKYAPLENNGTSEVYKKSQRPETAEVIQKIAEEFADTDLAGYYCSGPIRQASLNSKGQFHYFEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HVU7-F1 | 139-445 | 96.67 | 97.28 | View in AlphaFoldDB ↗ |