DPCfam | MC164218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Residues in low-complexity regions (%) | 0.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03175 |
| Sequences matching dominant architecture (%) | 89.86 |
| Average overlap percent | 39.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F8Y324 | 8-117 | 110 | RRIRIVDTWTLFRCPLSKLGELVGLEKLPMPAADAGAAAWNTYNRRDVEILLAAVTETIDFLVDEELGSYQDTVASLAWNAYRHR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0G3N8-F1 | 351-494 | 97.79 | 92.52 | View in AlphaFoldDB ↗ |