DPCfam | MC164213
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 216 ± 43 aa |
| Residues in low-complexity regions (%) | 3.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10972 |
| Sequences matching dominant architecture (%) | 84.11 |
| Average overlap percent | 75.37 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005F80744 | 55-367 | 313 | WYQIELVIFKRAEQNTADKEIWPKNIALGYPANLQHLIDPTIALLDLDNAALAPTTEEQHPNADETLLELEEALPTQALAFEDDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZK2-F1 | 24-174 | 98.97 | 94.84 | View in AlphaFoldDB ↗ |