DPCfam | MC164198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 150 ± 14 aa |
| Residues in low-complexity regions (%) | 3.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00456 |
| Sequences matching dominant architecture (%) | 63.49 |
| Average overlap percent | 8.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0X3QWV5 | 258-432 | 175 | NCNLQRLDGPVRGNGKIIQELEGVFRGGGWNVIKLLWGGYWDALLAKDTNGVLKKLMMETVDGEYQNCKAFGGAYTREHFFGKYP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59097-F1 | 280-433 | 99.36 | 93.21 | View in AlphaFoldDB ↗ |